Lot 2L5 · 5 mg vial · Freedom Diagnostics · reported 9 June 2026 . The bar shows where the reported result falls against Astramide’s published release criterion. The notch marks the criterion.
Within criterionAbove criterionNot on this COA
Test
Method
Criterion
Result
Result vs criterion
Status
Identity
LC-MS
LC-MS match to the labelled compound
Confirmed
WITHIN SPEC
Chromatographic purity
HPLC-UV
at or above 98.0%
99.83%
95at or above 98.0%100
WITHIN SPEC
Net content
HPLC-UV
6.03 mg
80120
REPORTED
Endotoxin
LAL, USP <85>
below the 0.05 EU/mL assay sensitivity
Pass, 2 of 2 at ≤0.05 EU/mL
WITHIN SPEC
Appearance
Visual
white lyophilized powder
White Lyophilized Powder
WITHIN SPEC
Values are reported per vial or bottle unless otherwise noted. Every figure here is taken from the batch Certificate of Analysis and nothing else.
Freedom Diagnostics · 1 page · served inline, not a screenshot
Quick reference
How to read this report
Same six keys on every Astramide product page. Only the values change.
1Lot numberMatch it to the number printed on your product label. If they differ, this report is not for your product.
2IdentityMass spectrometry confirms the molecule is the one on the label. It conforms or it does not. There is no partial result.
3Chromatographic purityThe share of the material that is the target peptide. A purity figure quoted without a method is not a purity figure.
4Net contentHow much compound is in each vial or bottle, as measured by the laboratory. A different question from purity.
5EndotoxinMeasured against a ceiling, not a floor. Sensitivity differs by laboratory, so results are not compared across labs.
6Laboratory, method, dateWho ran it, on what instrument, and when. A report with no named laboratory or no date is not a report.
Molecular profile
LL-37, in structural terms.
Sequence
[LL-37, 37 aa]
Molecular formula
C₂₀₅H₃₄₀N₆₀O₅₃
Molecular weight
4493 g/mol
CAS number
154947-66-7 — LL-37 (unmodified peptide)This registry number resolves to PubChem CID 16198951, C₂₀₅H₃₄₀N₆₀O₅₃, molecular weight 4493, listed under the synonyms LL-37, cathelicidin LL-37 and ropocamptide. It identifies the unmodified peptide, not an amide or trifluoroacetate salt form. The peptide corresponds to residues 134–170 of the human cathelicidin antimicrobial peptide precursor, UniProt P49913.
Structure type
Linear peptide
Primary molecular target
Anionic microbial membranes (lipopolysaccharide and lipoteichoic acid); formyl peptide receptor 2 (FPR2/ALX); P2X7 purinergic receptor; Toll-like receptor signalling componentsLL-37 adopts an amphipathic alpha-helical conformation on contact with anionic surfaces. This conformational change is the structural basis of its membrane-interaction behaviour in published in vitro work.
LL-37 continues to be evaluated for its relevance in experimental biology, particularly within studies involving antimicrobial peptide mechanisms, innate immunity, membrane biology, host-defense signaling, inflammatory pathways, and peptide-structure/function relationships.Its 37-amino-acid sequence and cationic, amphipathic characteristics make LL-37 particularly relevant to laboratory investigations examining peptide-membrane interactions and host-defense mechanisms.The peptide is manufactured by solid-phase peptide synthesis.
In preclinical and laboratory research models, LL-37 has been investigated across microbiological, immunological, biochemical, and cellular systems. Research areas include:
Host-defense peptide biology
Microbial membrane interactions
Innate immune signaling
Leukocyte and immune-cell signaling
Cytokine-associated pathways
Epithelial cell biology Endotoxin interactions
Cellular membrane models
Tissue-repair and re-epithelialization pathways
LL-37’s positive charge and amphipathic structure contribute to its interactions with negatively charged microbial membrane components. Research has also examined functions extending beyond direct antimicrobial activity, including immune-cell signaling and epithelial responses.
These observations are limited to controlled experimental environments and support ongoing laboratory investigation.
These are published research systems. They do not describe approved clinical applications, and they do not establish efficacy or safety in humans.
Cited literature
Chen X et al., 2023. Antimicrobial peptide LL-37 disrupts plasma membrane and calcium homeostasis in Candida albicans via the Rim101 pathway. Microbiol Spectr. PMID 37888991. https://pubmed.ncbi.nlm.nih.gov/37888991/
Extensive published literature. LL-37 is the C-terminal fragment of human cathelicidin hCAP18 and appears widely across the published innate-immunity and membrane-biophysics literature, predominantly in microbiological, biophysical and cell-culture studies. This describes the evidence base surrounding the molecule and does not imply approval or established efficacy for the research material supplied here.
Handling and storage
As supplied
Lyophilized powder in a sealed vial. Held in laboratory-rated freezers from arrival to shipment.
Storage
Store per the conditions printed on the vial label. Avoid heat, moisture and repeated temperature cycling.
Handling
For qualified professionals in controlled laboratory environments, following validated laboratory procedures.
Frequently asked questions
About this compound and its batch data.
What purity did this LL-37 batch achieve?
Lot 2L5 was analysed by Freedom Diagnostics and returned chromatographic purity of 99.83% by HPLC with UV detection coupled to mass spectrometry. Identity was confirmed by mass spectral match. The full certificate is published on this page, and every figure shown here is taken from it.
How much LL-37 is in the vial?
The laboratory measured 6.03 mg, which is 120.6% of the label claim. Net content is reported on a per-vial basis. Astramide publishes the measured figure rather than the label claim, whether it falls above or below.
Was this LL-37 batch tested for endotoxins?
Yes. Endotoxin testing was performed using the Limulus Amebocyte Lysate assay in accordance with USP <85>, and this batch returned Pass, 2 of 2 at ≤0.05 EU/mL. The result appears on the certificate published on this page.
How should LL-37 be stored for research use?
As supplied, the lyophilized powder should be held at -20°C and protected from light and moisture. Once reconstituted, store at 2-8°C and use within 14 to 30 days. Avoid repeated freeze-thaw cycles and follow the handling procedures appropriate to your laboratory.
What is the difference between research-grade and pharmaceutical-grade LL-37?
These are separate classifications. Research-grade material is supplied for laboratory research use only and is not intended for human or animal consumption. Pharmaceutical-grade is an FDA classification that applies to drugs manufactured for human use. Astramide supplies research-grade material only.
How can I verify this LL-37 certificate independently?
The certificate was issued by Freedom Diagnostics under lot 2L5, laboratory reference 2606080490. Quote that reference to the laboratory directly. The same document is published here in full, and is not summarised or reformatted by Astramide.
Research use only
This product is intended strictly for in-vitro laboratory research conducted by qualified professionals.
It is not intended for human or animal consumption, clinical use, or therapeutic application.
The statements on this page have not been reviewed by the FDA. These research peptides are not intended
to diagnose, treat, cure, or prevent any disease. Research Use Only.
Get It Now
This product has multiple variants. The options may be chosen on the product page
Added to your cart
Your cart is empty.
Your Privacy Choices
We use analytics and advertising tools to understand how visitors find us and which campaigns work. You can turn either off. Your choice is saved in this browser.
AnalyticsGoogle Analytics, Microsoft Clarity and order source tracking. Helps us see how the site is used and fix problems.
Off (browser signal)
AdvertisingMeta and X pixels, and server-side events. Opting out also opts you out of "sharing" and targeted advertising under state privacy laws.
Off (browser signal)
Your browser is sending a Global Privacy Control signal, so analytics and advertising are off. To change this, turn off the signal in your browser settings.
Strictly necessary cookies (cart, sign-in, checkout, entry acknowledgment) always stay on. See our Privacy Policy.
Know what's in it before you order.
Every Astramide batch is tested by an independent US lab. The report goes public before the batch goes on sale, so you can check the numbers first.
Independent US lab test on every batch
Full report published before it goes on sale
Kept frozen, shipped from Austin, Texas
GLP-3RLot 2026/02 · May 8, 2026
>99.9%purity by HPLC-UV/MS
90%Minimum 98.0%100%
Identity: Confirmed by mass specEndotoxin: Below 0.5 EU/mL
Pro Series
