| Pcs | Single Vial, Pack of 10 |
|---|---|
| Strength | 10mg, 15mg, 30mg |
GLP-1S
An acylated synthetic agonist peptide at the GLP-1 receptor
CAS 910463-68-2C₁₈₇H₂₉₁N₄₅O₅₉4113.6 g/molLinear peptideLyophilized powder
Price range: $64.99 through $1,040.00
Ships from Austin, TexasUnited States only
Tested by an outside labNever in-house
Every lot publishedIncluding rejected lots
Same-day dispatchOn orders before 2pm ET
BATCH
VERIFICATION
VERIFICATION
LOT NUMBER
2026/02
IDENTITY
Confirmed
CHROMATOGRAPHIC PURITY
>99.9 %
NET CONTENT
15.3 mg
Quick reference
How to read this report
Same six keys on every Astramide product page. Only the values change.
1Lot numberMatch it to the number printed on your vial. If they differ, this report is not for your vial.
2IdentityMass spectrometry confirms the molecule is the one on the label. It conforms or it does not. There is no partial result.
3Chromatographic purityThe share of the material that is the target peptide. A purity figure quoted without a method is not a purity figure.
4Net contentHow much peptide is in the vial, as measured by the laboratory. A different question from purity.
5EndotoxinMeasured against a ceiling, not a floor. Sensitivity differs by laboratory, so results are not compared across labs.
6Laboratory, method, dateWho ran it, on what instrument, and when. A report with no named laboratory or no date is not a report.
Molecular profile
GLP-1S, in structural terms.
- Sequence
- GLP-1S is an acylated analogue built on the human glucagon-like peptide-1 backbone. The native reference sequence, GLP-1(7-37), is: His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly One-letter representation: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG This is a 31-residue peptide corresponding to residues 98–128 of the human proglucagon precursor (UniProt P01275). The analogue supplied here differs from that reference at three points: alpha-aminoisobutyric acid replaces the alanine at position 8, arginine replaces the lysine at position 34, and a C18 diacid fatty-acid chain is attached to the lysine at position 26 through a gamma-glutamate unit and two AEEA spacers. The acylation is the structural feature that extends circulating half-life relative to the native peptide, by promoting reversible albumin binding. Identity for each lot is confirmed by mass spectrometric match to the labelled compound and reported on the certificate of analysis published on this page.
- Molecular formula
- C₁₈₇H₂₉₁N₄₅O₅₉
- Molecular weight
- 4113.6 g/mol
- CAS number
- 910463-68-2
- Structure type
- Linear peptide
- Primary molecular target
- Glucagon-like peptide-1 receptor (GLP-1R), a class B G-protein-coupled receptor
- Physical form
- Lyophilized powder
- PubChem CID
- 56843331
GLP-1 continues to be evaluated for its relevance in experimental biology, particularly within studies involving incretin signaling, receptor-level interactions, and biochemical pathway analysis.
Research profile
Where GLP-1S appears in the literature.
Receptor Pharmacology; Peptide Chemistry; Structural Biology; Class B G-Protein-Coupled Receptor Research; Cell Signaling
Research applications
- GLP-1 receptor binding studies
- Class B GPCR structural biology
- Receptor-Gs complex cryo-EM studies
- cAMP second-messenger signaling research
- Receptor trafficking and recycling studies
- Peptide acylation and albumin-binding chemistry
- Biased agonism research
Experimental systems
- GLP-1 receptor-expressing cell lines
- Receptor-Gs complex preparations for cryo-EM
- Isolated pancreatic cell models
- cAMP reporter systems
- Radioligand binding preparations
- Membrane preparations
Specific assays
- HPLC-UV purity analysis
- Mass spectrometry identity confirmation
- LAL endotoxin assay (USP <85>)
- Radioligand receptor binding assays
- cAMP accumulation assays
- Cryo-electron microscopy structure determination
- Receptor internalisation and recycling assays
- Beta-arrestin recruitment assays
Measured endpoints
- Chromatographic purity
- Peptide identity
- Net peptide content
- Endotoxin assay result
- Receptor binding affinity
- Intracellular cAMP accumulation
- Receptor conformational state
- Receptor internalisation rate
Mechanism and research context
What has been studied, and in what systems.
In preclinical and laboratory research models, Sema has been examined across metabolic, endocrine, and cardiovascular research systems. Research focus includes:
GLP-1 receptor signaling pathways
Incretin-related activity models
Hormonal pathway interactions
Cellular signaling mechanisms
These observations are limited to controlled experimental environments and support ongoing laboratory investigations.
These are published research systems. They do not describe approved clinical applications, and they do not establish efficacy or safety in humans.
Cited literature
Zhang Y et al., 2017. Cryo-EM structure of the activated GLP-1 receptor in complex with a G protein. Nature. PMID 28538729. https://pubmed.ncbi.nlm.nih.gov/28538729/
Liang YL et al., 2018. Phase-plate cryo-EM structure of a biased agonist-bound human GLP-1 receptor-Gs complex. Nature. PMID 29466332. https://pubmed.ncbi.nlm.nih.gov/29466332/
Cary BP et al., 2022. Structural and functional diversity among agonist-bound states of the GLP-1 receptor. Nat Chem Biol. PMID 34937906. https://pubmed.ncbi.nlm.nih.gov/34937906/
Zhang X et al., 2020. Differential GLP-1R Binding and Activation by Peptide and Non-peptide Agonists. Mol Cell. PMID 33027691. https://pubmed.ncbi.nlm.nih.gov/33027691/
Evidence level
Extensive published literature. This compound is an acylated GLP-1 receptor agonist peptide and the receptor system is among the most structurally characterised in class B GPCR research, with published cryo-EM structures and detailed binding studies. This describes the evidence base surrounding the molecule and does not imply approval or established efficacy for the research material supplied here.
Handling and storage
As supplied
Lyophilized powder in a sealed vial. Held in laboratory-rated freezers from arrival to shipment.
Storage
Store per the conditions printed on the vial label. Avoid heat, moisture and repeated temperature cycling.
Handling
For qualified professionals in controlled laboratory environments, following validated laboratory procedures.
Frequently asked questions
About this compound and its batch data.
What purity did this GLP-1 batch achieve?
Lot 2026/02 was analysed by Krause Analytical and returned chromatographic purity of >99.9 % by HPLC with UV detection coupled to mass spectrometry. Identity was confirmed by mass spectral match. The full certificate is published on this page, and every figure shown here is taken from it.
How much GLP-1 is in the vial?
The laboratory measured 15.3 mg, which is 101.7% of the label claim. Net content is reported on a per-vial basis. Astramide publishes the measured figure rather than the label claim, whether it falls above or below.
Was this GLP-1 batch tested for endotoxins?
Yes. Endotoxin testing was performed using the Limulus Amebocyte Lysate assay in accordance with USP <85>, and this batch returned <0.5 EU/mL. The result appears on the certificate published on this page.
How should GLP-1 be stored for research use?
As supplied, the lyophilized powder should be held at -20°C and protected from light and moisture. Once reconstituted, store at 2-8°C and use within 14 to 30 days. Avoid repeated freeze-thaw cycles and follow the handling procedures appropriate to your laboratory.
What is the difference between research-grade and pharmaceutical-grade GLP-1?
These are separate classifications. Research-grade material is supplied for laboratory research use only and is not intended for human or animal consumption. Pharmaceutical-grade is an FDA classification that applies to drugs manufactured for human use. Astramide supplies research-grade material only.
How can I verify this GLP-1 certificate independently?
The certificate was issued by Krause Analytical under lot 2026/02, laboratory reference 205078. Quote that reference to the laboratory directly. The same document is published here in full, and is not summarised or reformatted by Astramide.
Research use only
This product is intended strictly for in-vitro laboratory research conducted by qualified professionals. It is not intended for human or animal consumption, clinical use, or therapeutic application. The statements on this page have not been reviewed by the FDA. These research peptides are not intended to diagnose, treat, cure, or prevent any disease. Research Use Only.
COA library
Every lot we have tested
Search by batch number. Past lots stay published.
How we test
The analytical panel
What each method measures and the criterion each lot must meet.
Open Lab
Send us your peptides
Any vendor. Same lab. Your own Certificate of Analysis.
Ships from Austin, TexasUPS Ground, about 3 business days
United States onlyFree shipping at $150 and over
Tracked on every orderTracking number emailed when it ships
Replacement or store creditOn approved claims. See refund policy.
Related products
-
GLP-2T
Price range: $89.00 through $1,620.00Select options This product has multiple variants. The options may be chosen on the product page -
Pro SeriesGLP-3R – Pro
Price range: $129.00 through $2,331.00Select options This product has multiple variants. The options may be chosen on the product page -
Pro SeriesGLP-2T Pro
Price range: $109.00 through $1,431.00Select options This product has multiple variants. The options may be chosen on the product page -
Pro SeriesB-12 (Cyanocobalamin) Pro
$44.99
