🔍
GLP-2T

GLP-2T

A synthetic dual agonist peptide at the GIP and GLP-1 receptors
CAS 2023788-19-2C₂₂₅H₃₆₀N₆₂O₈₅4813.5 g/molLinear peptideLyophilized powder

Price range: $89.00 through $1,620.00

Ships from lot 2026/02 · >99.9 % purity · Krause Analytical See the COA
Also available in the Pro Series.Its own lot. Its own certificate.
See GLP-2T Pro
Ships from Austin, TexasUnited States only
Tested by an outside labNever in-house
Every lot publishedIncluding rejected lots
Same-day dispatchOn orders before 2pm ET
SKU: N/A Category:
BATCH
VERIFICATION
LOT NUMBER
2026/02
IDENTITY
Confirmed
CHROMATOGRAPHIC PURITY
>99.9 %
NET CONTENT
8.65 mg
Analytical characterization

Every result against its specification.

Lot 2026/02 · Krause Analytical · reported 8 May 2026 . The bar shows where the reported result falls against Astramide’s published release criterion. The notch marks the criterion.
Within criterion Above criterion Not on this COA
Test
Method
Criterion
Result
Result vs criterion
Status
Identity
HPLC-UV-MS
Mass spectral match to the labelled compound
Confirmed
WITHIN SPEC
Chromatographic purity
HPLC-UV/MS
at or above 98.0%
>99.9 %
95 at or above 98.0% 100
WITHIN SPEC
Net content
HPLC-UV-MS
8.65 mg
80 120
REPORTED
Endotoxin
LAL, USP <85>
below 0.5 EU/mL
<0.5 EU/mL
WITHIN SPEC
Values are reported per vial unless otherwise noted. Every figure here is taken from the batch Certificate of Analysis and nothing else.
Certificate of Analysis
GLP-2T · Lot 2026/02 · Lab No. 205082
Download Full screen
Your browser cannot display the report inline. Open the PDF.
Krause Analytical · 3 pages · served inline, not a screenshot
Quick reference

How to read this report

Same six keys on every Astramide product page. Only the values change.
1Lot numberMatch it to the number printed on your vial. If they differ, this report is not for your vial.
2IdentityMass spectrometry confirms the molecule is the one on the label. It conforms or it does not. There is no partial result.
3Chromatographic purityThe share of the material that is the target peptide. A purity figure quoted without a method is not a purity figure.
4Net contentHow much peptide is in the vial, as measured by the laboratory. A different question from purity.
5EndotoxinMeasured against a ceiling, not a floor. Sensitivity differs by laboratory, so results are not compared across labs.
6Laboratory, method, dateWho ran it, on what instrument, and when. A report with no named laboratory or no date is not a report.
Molecular profile

GLP-2T, in structural terms.

GLP-2T molecular structure
Sequence
GLP-2T is a 39-residue acylated analogue built on the human gastric inhibitory polypeptide (GIP) backbone. The native reference sequence, GIP(1-42), is: Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln One-letter representation: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ The native peptide is 42 residues, corresponding to residues 52–93 of the human GIP precursor (UniProt P09681). The analogue supplied here is shorter at 39 residues and is C-terminally amidated. It carries alpha-aminoisobutyric acid at two positions in the N-terminal region, which resists dipeptidyl peptidase-4 cleavage, and a C20 diacid fatty-acid chain attached to a lysine through a gamma-glutamate unit and two AEEA spacers. Its receptor binding profile spans more than one class B receptor, which is the property that distinguishes it from single-receptor analogues of this family. Identity for each lot is confirmed by mass spectrometric match to the labelled compound and reported on the certificate of analysis published on this page.
Molecular formula
C₂₂₅H₃₆₀N₆₂O₈₅
Molecular weight
4813.5 g/mol
CAS number
2023788-19-2
Structure type
Linear peptide
Primary molecular target
Class B (secretin-family) G protein-coupled incretin receptorsReceptors in this family share a large extracellular domain that binds the C-terminal portion of the peptide ligand, while the N-terminal portion engages the transmembrane core to drive receptor activation. This two-domain binding model is established in the structural literature for the class.
Physical form
Lyophilized powder
PubChem CID
166567236

GLP-2 continues to be evaluated for its relevance in experimental biology, particularly within studies involving incretin signaling, receptor-level interactions, and biochemical pathway analysis.The peptide is manufactured by solid-phase peptide synthesis.

Research profile

Where GLP-2T appears in the literature.

Receptor Pharmacology; Structural Biology; Peptide Biochemistry; Analytical Chemistry
Research applications
  • Published experimental use of class B incretin receptor ligands includes:
  • Receptor binding and competition studies at recombinant receptors
  • cAMP accumulation and β-arrestin recruitment assays
  • Cryo-electron microscopy of peptide–receptor–G protein complexes
  • Receptor selectivity profiling across related class B receptors
  • Biased signalling and receptor internalisation studies
  • Analytical characterisation of synthetic peptide analogues by HPLC and high-resolution mass spectrometry
  • These areas describe experimental research contexts and do not establish therapeutic efficacy or safety in humans.
Experimental systems
  • Experimental systems reported in this literature include:
  • HEK293 and CHO cell lines stably expressing recombinant class B receptors
  • Purified receptor–G protein complexes for structural determination
  • Membrane preparations for radioligand binding
  • Cell-free biophysical systems for peptide conformational study
  • Isolated cell models used in published receptor pharmacology
Specific assays
  • Assay formats reported in this literature include:
  • Competition radioligand and fluorescent ligand binding assays
  • HTRF and BRET cAMP accumulation assays
  • β-arrestin recruitment and receptor internalisation assays
  • Single-particle cryo-EM structure determination
  • Reversed-phase HPLC with UV and mass spectrometric detection
  • Circular dichroism for secondary structure assessment
Measured endpoints
  • Endpoints reported in published research on this receptor class include:
  • Binding affinity (Ki) and functional potency (EC50)
  • Receptor selectivity ratios across related class B receptors
  • cAMP accumulation and β-arrestin recruitment relative to reference ligand
  • Receptor–ligand complex resolution and modelled contacts
  • Chromatographic purity and mass accuracy for synthetic preparations
  • Research use only. Not for human or animal consumption.
Pcs

Single Vial, Pack of 10
Strength

10mg, 15mg, 30mg
Mechanism and research context

What has been studied, and in what systems.

In preclinical and laboratory research models, GLP-2T has been examined across hormonal, cellular, and molecular research systems. Research focus includes:
GLP-1 receptor signaling pathways
GIP receptor interaction models
Dual incretin receptor activity
Cellular signaling mechanisms
These observations are limited to controlled experimental environments and support ongoing laboratory investigations.

These are published research systems. They do not describe approved clinical applications, and they do not establish efficacy or safety in humans.

Cited literature

Brubaker PL et al., 2002. Structure-function of the glucagon receptor family of G protein-coupled receptors: the glucagon, GIP, GLP-1, and GLP-2 receptors. Recept Channels. PMID 12529935. https://pubmed.ncbi.nlm.nih.gov/12529935/

Novikoff A et al., 2021. Spatiotemporal GLP-1 and GIP receptor signaling and trafficking/recycling dynamics induced by selected receptor mono- and dual-agonists. Mol Metab. PMID 33556643. https://pubmed.ncbi.nlm.nih.gov/33556643/

Dinsmore I et al., 2024. Potent and Protease Resistant Azapeptide Agonists of the GLP-1 and GIP Receptors. Angew Chem Int Ed Engl. PMID 39151024. https://pubmed.ncbi.nlm.nih.gov/39151024/

Evidence level
The structural and signalling pharmacology of class B incretin receptors is well characterised in the published structural biology literature. Statements on this page describe receptor biochemistry and analytical characterisation in experimental systems. No claim is made regarding outcomes in humans, and this material is supplied for laboratory research use only.
Handling and storage
As supplied
Lyophilized powder in a sealed vial. Held in laboratory-rated freezers from arrival to shipment.
Storage
Store per the conditions printed on the vial label. Avoid heat, moisture and repeated temperature cycling.
Handling
For qualified professionals in controlled laboratory environments, following validated laboratory procedures.
Frequently asked questions

About this compound and its batch data.

What purity did this GLP-2 batch achieve?

Lot 2026/02 was analysed by Krause Analytical and returned chromatographic purity of >99.9 % by HPLC with UV detection coupled to mass spectrometry. Identity was confirmed by mass spectral match. The full certificate is published on this page, and every figure shown here is taken from it.

How much GLP-2 is in the vial?

The laboratory measured 8.65 mg, which is 86.5% of the label claim. Net content is reported on a per-vial basis. Astramide publishes the measured figure rather than the label claim, whether it falls above or below.

Was this GLP-2 batch tested for endotoxins?

Yes. Endotoxin testing was performed using the Limulus Amebocyte Lysate assay in accordance with USP <85>, and this batch returned <0.5 EU/mL. The result appears on the certificate published on this page.

How should GLP-2 be stored for research use?

As supplied, the lyophilized powder should be held at -20°C and protected from light and moisture. Once reconstituted, store at 2-8°C and use within 14 to 30 days. Avoid repeated freeze-thaw cycles and follow the handling procedures appropriate to your laboratory.

What is the difference between research-grade and pharmaceutical-grade GLP-2?

These are separate classifications. Research-grade material is supplied for laboratory research use only and is not intended for human or animal consumption. Pharmaceutical-grade is an FDA classification that applies to drugs manufactured for human use. Astramide supplies research-grade material only.

How can I verify this GLP-2 certificate independently?

The certificate was issued by Krause Analytical under lot 2026/02, laboratory reference 205082. Quote that reference to the laboratory directly. The same document is published here in full, and is not summarised or reformatted by Astramide.

Research use only

This product is intended strictly for in-vitro laboratory research conducted by qualified professionals. It is not intended for human or animal consumption, clinical use, or therapeutic application. The statements on this page have not been reviewed by the FDA. These research peptides are not intended to diagnose, treat, cure, or prevent any disease. Research Use Only.

COA library Every lot we have tested Search by batch number. Past lots stay published. How we test The analytical panel What each method measures and the criterion each lot must meet. Open Lab Send us your peptides Any vendor. Same lab. Your own Certificate of Analysis.
Ships from Austin, TexasUPS Ground, about 3 business days
United States onlyFree shipping at $150 and over
Tracked on every orderTracking number emailed when it ships
Replacement or store creditOn approved claims. See refund policy.

Related products