Lot 2026/02 · 1 mg vial · Krause Analytical · reported 13 May 2026 . The bar shows where the reported result falls against Astramide’s published release criterion. The notch marks the criterion.
Within criterionAbove criterionNot on this COA
Test
Method
Criterion
Result
Result vs criterion
Status
Identity
HPLC-UV-MS
Mass spectral match to the labelled compound
Confirmed
WITHIN SPEC
Chromatographic purity
HPLC-UV/MS
at or above 98.0%
>99.9 %
95at or above 98.0%100
WITHIN SPEC
Net content
HPLC-UV-MS
1.10 mg
80120
REPORTED
Endotoxin
LAL, USP <85>
below 0.5 EU/mL
<0.5 EU/mL
WITHIN SPEC
Values are reported per vial or bottle unless otherwise noted. Every figure here is taken from the batch Certificate of Analysis and nothing else.
Krause Analytical · 3 pages · served inline, not a screenshot
Quick reference
How to read this report
Same six keys on every Astramide product page. Only the values change.
1Lot numberMatch it to the number printed on your product label. If they differ, this report is not for your product.
2IdentityMass spectrometry confirms the molecule is the one on the label. It conforms or it does not. There is no partial result.
3Chromatographic purityThe share of the material that is the target peptide. A purity figure quoted without a method is not a purity figure.
4Net contentHow much compound is in each vial or bottle, as measured by the laboratory. A different question from purity.
5EndotoxinMeasured against a ceiling, not a floor. Sensitivity differs by laboratory, so results are not compared across labs.
6Laboratory, method, dateWho ran it, on what instrument, and when. A report with no named laboratory or no date is not a report.
Molecular profile
IGF-1 LR3, in structural terms.
Sequence
MFPAMPLSSLFVN-GPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
IGF-1 LR3 is an 83-residue analogue of human insulin-like growth factor 1. It differs from the 70-residue mature human sequence (UniProt P05019, residues 49–118) in two respects: the glutamate at position 3 is replaced by arginine, and a 13-residue extension (MFPAMPLSSLFVN) is present at the N-terminus.
Molecular formula
C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉
Molecular weight
Approximately 9,111 Da
CAS number
946870-92-4
Structure type
Linear peptide
Primary molecular target
Type 1 insulin-like growth factor receptor (IGF1R); insulin-like growth factor binding proteins (IGFBP-1 to IGFBP-6)
The arginine substitution at position 3 substantially lowers affinity for the IGFBP family relative to native IGF-1. This property is the reason the analogue is used as a comparator in binding-protein research.
Physical form
Lyophilized powder
IGF-1 LR3 continues to be evaluated in experimental biology, particularly within studies involving growth-factor receptor activation, IGF-binding protein interactions, intracellular signaling, cellular proliferation and differentiation, and biochemical pathway analysis.
Its 83-amino-acid structure and reduced affinity for IGF-binding proteins distinguish IGF-1 LR3 from native 70-amino-acid IGF-1 and make it useful for laboratory investigations of the IGF signaling system.
In laboratory and preclinical research systems, IGF-1 LR3 has been investigated across growth-factor, receptor-signaling, biochemical, and cellular models. Research areas include:
IGF-1 receptor (IGF-1R) signaling
IGF-binding protein interactions
Growth-factor biology
Cellular proliferation pathways
Cellular differentiation models
Protein synthesis signaling
PI3K/Akt pathway research
MAPK signaling
Metabolic signaling
Cell-culture growth models
The structural modifications of Long R3 IGF-I markedly reduce its interaction with IGF-binding proteins compared with native IGF-I, which is one reason the analog is useful as an experimental reagent in systems containing IGFBPs.
These observations relate to controlled experimental systems and do not establish therapeutic efficacy or safety in humans.
These are published research systems. They do not describe approved clinical applications, and they do not establish efficacy or safety in humans.
Cited literature
Bryant J et al., 1996. Design and characterisation of long-R3-insulin-like growth factor-I muteins which show resistance to pepsin digestion. Growth Factors. PMID 8919033. https://pubmed.ncbi.nlm.nih.gov/8919033/
Devi GR et al., 2001. Effect of IGFBP-3 on IGF- and IGF-analogue-induced insulin-like growth factor-I receptor (IGFIR) signalling. Growth Horm IGF Res. PMID 11735239. https://pubmed.ncbi.nlm.nih.gov/11735239/
Evidence level
Extensive published literature. Long R3 IGF-1 is an engineered analogue of insulin-like growth factor I designed for reduced IGF binding protein affinity, and both the parent molecule and the analogue appear across the published growth-factor and receptor-signaling literature, predominantly in biochemical and cell-culture studies. This describes the evidence base surrounding the molecule and does not imply approval or established efficacy for the research material supplied here.
Handling and storage
As supplied
Lyophilized powder in a sealed vial. Held in laboratory-rated freezers from arrival to shipment.
Storage
Store per the conditions printed on the vial label. Avoid heat, moisture and repeated temperature cycling.
Handling
For qualified professionals in controlled laboratory environments, following validated laboratory procedures.
Frequently asked questions
About this compound and its batch data.
What is IGF-1 LR3?
IGF-1 LR3, or Long R3 IGF-1, is an 83-residue analogue of human insulin-like growth factor 1. It carries arginine in place of glutamate at position 3 and a 13-residue N-terminal extension. CAS 946870-92-4. Astramide supplies it as a lyophilized powder for laboratory research use only. It is not intended for human or animal consumption, clinical use, or therapeutic application.
What has IGF-1 LR3 been examined for in published research?
In cell-based studies of IGF-1 receptor signalling, IGFBP-3 inhibited receptor phosphorylation induced by IGF-I, IGF-II and Long R3 IGF-I, an effect the authors attributed to binding and sequestering the ligands (Devi et al., 2001, PMID 11735239). Published work is pre-clinical. Astramide makes no claim about outcomes in humans.
What purity does the current IGF-1 LR3 lot reach?
Lot 2026/02 returned greater than 99.9% chromatographic purity by HPLC-UV/MS, tested by Krause Analytical under Lab No. 205070 and reported 13 May 2026. Identity was confirmed by mass spectral match. The full Certificate of Analysis is published on the lot record and is downloadable as the laboratory’s own PDF.
How much IGF-1 LR3 is in the vial?
The label claim is 1 mg. Lot 2026/02 measured 1.10 mg of IGF-1 LR3, which is 110% of label. Astramide publishes the measured figure rather than the label figure. Net content is a separate question from purity.
How is Astramide's IGF-1 LR3 tested?
Testing is performed by Krause Analytical, a DEA-registered, ISO/IEC 17025-certified laboratory in Austin, Texas. Lot 2026/02 was analysed by four methods: identity by mass spectral match, chromatographic purity by HPLC-UV/MS, net content by HPLC-UV-MS, and endotoxin by USP 85. Heavy metals, microbial and pH were not performed on this lot, and the page shows those rows as not reported.
How should IGF-1 LR3 be stored for research use?
Lyophilized material is stored at -20C and protected from light. Once reconstituted, storage is 2 to 8C with use within 14 to 30 days. Storage conditions affect peptide stability, and results from this lot apply to material handled within these conditions.
What is the difference between research-grade and pharmaceutical-grade IGF-1 LR3?
These are separate classifications. Research-grade material is supplied for laboratory research use only and is not manufactured, tested or released under the regulatory framework that governs drugs for human use. Pharmaceutical-grade is an FDA classification for human-use products. Astramide supplies research-grade material exclusively and does not represent it as pharmaceutical-grade.
How does IGF-1 LR3 differ from native IGF-1?
Native mature IGF-1 has 70 residues. IGF-1 LR3 has 83: the same core sequence with arginine substituted for glutamate at position 3, plus a 13-residue extension, MFPAMPLSSLFVN, at the N-terminus. Its molecular weight is approximately 9,111 Da. The two are separate compounds and are not interchangeable in an experiment.
Research use only
This product is intended strictly for in-vitro laboratory research conducted by qualified professionals.
It is not intended for human or animal consumption, clinical use, or therapeutic application.
The statements on this page have not been reviewed by the FDA. These research peptides are not intended
to diagnose, treat, cure, or prevent any disease. Research Use Only.
Get It Now
This product has multiple variants. The options may be chosen on the product page
Added to your cart
Your cart is empty.
Your Privacy Choices
We use analytics and advertising tools to understand how visitors find us and which campaigns work. You can turn either off. Your choice is saved in this browser.
AnalyticsGoogle Analytics, Microsoft Clarity and order source tracking. Helps us see how the site is used and fix problems.
Off (browser signal)
AdvertisingMeta and X pixels, and server-side events. Opting out also opts you out of "sharing" and targeted advertising under state privacy laws.
Off (browser signal)
Your browser is sending a Global Privacy Control signal, so analytics and advertising are off. To change this, turn off the signal in your browser settings.
Strictly necessary cookies (cart, sign-in, checkout, entry acknowledgment) always stay on. See our Privacy Policy.
Know what's in it before you order.
Every Astramide batch is tested by an independent US lab. The report goes public before the batch goes on sale, so you can check the numbers first.
Independent US lab test on every batch
Full report published before it goes on sale
Kept frozen, shipped from Austin, Texas
GLP-3RLot 2026/02 · May 8, 2026
>99.9%purity by HPLC-UV/MS
90%Minimum 98.0%100%
Identity: Confirmed by mass specEndotoxin: Below 0.5 EU/mL
Pro Series
Pro Series
