🔍
Sermorelin Pro research peptide vial and box

Sermorelin – Pro

Pro Series
Sermorelin, the synthetic 1-29 amide fragment of human GHRH (29 amino acids)
CAS 86168-78-7C₁₄₉H₂₄₆N₄₄O₄₂SApproximately 3357.9 g/mol29 amino acidsLinear peptideLyophilized powder

Price range: $74.99 through $700.00

Ships from lot PLB-SER-20260712-01 · 10 mg vial · 99% purity · pH Solutions Lab See the COA
Why the Pro Series costs more
  • Synthesized in the USA. Domestic ground and air only, no ocean freight.
  • Released only above 99% HPLC purity.
  • Its own lot and its own published certificate.
How the Pro Series is made and tested
Ships from Austin, TexasUnited States only
Tested by an outside labNever in-house
Every lot publishedIncluding rejected lots
Same-day dispatchOn orders before 2pm ET
SKU: N/A Category: Tags: ,
BATCH
VERIFICATION
LOT NUMBER
PLB-SER-20260712-01
10 mg vial
IDENTITY
Supported by HPLC retention-time match to a certified reference standard (no mass spectrometry on this certificate)
CHROMATOGRAPHIC PURITY
99%
MICROBIAL PANEL
Pass, 6 organisms not detected in 1 g
Analytical characterization

Every result against its specification.

Lot PLB-SER-20260712-01 · 10 mg vial · pH Solutions Lab · reported 5 September 2026 . The bar shows where the reported result falls against Astramide’s published release criterion. The notch marks the criterion.
Within criterion Above criterion Not on this COA
Test
Method
Criterion
Result
Result vs criterion
Status
Identity
HPLC retention time vs certified reference standard
Match to the labelled compound
Supported by HPLC retention-time match to a certified reference standard (no mass spectrometry on this certificate)
WITHIN SPEC
Chromatographic purity
HPLC (274 nm)
at or above 99.0%
99%
95 at or above 99.0% 100
WITHIN SPEC
Net content
—
Not reported on this certificate (target fill 10.00 mg per vial)
NOT REPORTED
Microbial panel
qPCR
not detected
Pass, 6 organisms not detected in 1 g
WITHIN SPEC
Water activity
Water activity meter
below 0.65 aw
0.46 aw, pass
WITHIN SPEC
Endotoxin
LAL
—
Not reported on this certificate
NOT REPORTED
Values are reported per vial unless otherwise noted. Every figure here is taken from the batch Certificate of Analysis and nothing else.
Certificate of Analysis
Sermorelin - Pro · Lot PLB-SER-20260712-01 · 10 mg vial · Lab No. PLB-SER-20260712-01
Download Full screen
Your browser cannot display the report inline. Open the PDF.
pH Solutions Lab · 2 pages · served inline, not a screenshot
Quick reference

How to read this report

Same six keys on every Astramide product page. Only the values change.
1Lot numberMatch it to the number printed on your vial. If they differ, this report is not for your vial.
2IdentityMass spectrometry confirms the molecule is the one on the label. It conforms or it does not. There is no partial result.
3Chromatographic purityThe share of the material that is the target peptide. A purity figure quoted without a method is not a purity figure.
4Net contentHow much peptide is in the vial, as measured by the laboratory. A different question from purity.
5EndotoxinMeasured against a ceiling, not a floor. Sensitivity differs by laboratory, so results are not compared across labs.
6Laboratory, method, dateWho ran it, on what instrument, and when. A report with no named laboratory or no date is not a report.
Molecular profile

Sermorelin - Pro, in structural terms.

Sermorelin - Pro molecular structure
Sequence
Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 (YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2)
Molecular formula
C₁₄₉H₂₄₆N₄₄O₄₂S
Molecular weight
Approximately 3357.9 g/mol
CAS number
86168-78-7
Peptide length
29 amino acids
Structure type
Linear peptide
Parent sequence
Human growth hormone-releasing hormone, residues 1-29 (of 44)
Primary molecular target
Growth hormone-releasing hormone receptor (GHRHR), a class B G protein-coupled receptor that signals mainly through Gs, adenylyl cyclase and cAMP.
Physical form
Lyophilized powder
PubChem CID
16132413

Sermorelin is a synthetic linear peptide of 29 amino acids with a C-terminal amide. Its sequence matches residues 1 to 29 of human growth hormone-releasing hormone (GHRH), a 44-amino-acid hypothalamic peptide. The 1-29 region has been studied as the shortest GHRH sequence that retains full receptor activity in structure-function work.

Research profile

Where Sermorelin - Pro appears in the literature.

Endocrinology; Neuroendocrinology; Receptor Pharmacology; Peptide Chemistry; Structural Biology
Research applications
  • Published studies have used sermorelin and GHRH(1-29)NH2 in:
  • GHRHR binding and competition studies
  • GHRH structure-activity and analogue design studies
  • Receptor activation and cAMP signaling studies
  • GHRHR structural biology
Experimental systems
  • Rat anterior pituitary (adenopituitary) membranes
  • Cell lines expressing recombinant GHRH receptor
  • Primary rat anterior pituitary cell cultures
  • Purified GHRH-GHRHR-Gs complexes for cryo-electron microscopy
Specific assays
  • Radioligand binding and competition assays
  • cAMP accumulation assays
  • Receptor cloning and expression
  • Cryo-electron microscopy
  • Peptide analogue synthesis and comparison
Measured endpoints
  • Binding affinity at GHRH receptor sites
  • Intracellular cAMP production
  • Receptor activation by GHRH fragments and analogues
  • Ligand-receptor contact residues in the GHRH-GHRHR complex
Pcs

Single Vial, Pack of 10
Strength

10mg
Mechanism and research context

What has been studied, and in what systems.

Sermorelin corresponds to the first 29 amino acids of human GHRH, with the C-terminal amide retained. Binding studies in rat adenopituitary membranes compared GHRH(1-29)NH2 with a series of analogues to map which residues govern affinity for GHRH binding sites (Gaudreau et al., 1992).

The GHRH receptor was cloned in 1992 and shown to be a pituitary-specific G protein-coupled receptor that raised intracellular cAMP when activated by GHRH in transfected cells (Mayo, 1992).

More recently, a cryo-electron microscopy structure of GHRH bound to its receptor and the Gs protein described how the N-terminal region of the peptide sits in the receptor binding pocket (Zhou et al., 2020). These studies place sermorelin in receptor pharmacology and structure-function research.

These are published research systems. They do not describe approved clinical applications, and they do not establish efficacy or safety in humans.

Cited literature

Mayo KE, 1992. Molecular cloning and expression of a pituitary-specific receptor for growth hormone-releasing hormone. Mol Endocrinol. PMID 1333056. https://pubmed.ncbi.nlm.nih.gov/1333056/
Gaudreau P et al., 1992. Affinity of human growth hormone-releasing factor (1-29)NH2 analogues for GRF binding sites in rat adenopituitary. J Med Chem. PMID 1534126. https://pubmed.ncbi.nlm.nih.gov/1534126/
Zhou F et al., 2020. Structural basis for activation of the growth hormone-releasing hormone receptor. Nat Commun. PMID 33060564. https://pubmed.ncbi.nlm.nih.gov/33060564/

Evidence level
GHRH receptor pharmacology and the activity of the GHRH(1-29) sequence are well characterised in binding, cell-signaling and structural studies. Statements on this page describe experimental systems, not outcomes in humans.
Handling and storage
As supplied
Lyophilized powder in a sealed vial. Held in laboratory-rated freezers from arrival to shipment.
Storage
Store per the conditions printed on the vial label. Avoid heat, moisture and repeated temperature cycling.
Handling
For qualified professionals in controlled laboratory environments, following validated laboratory procedures.
Frequently asked questions

About this compound and its batch data.

What is sermorelin peptide?

Sermorelin is a synthetic 29-amino-acid peptide matching residues 1 to 29 of human growth hormone-releasing hormone (GHRH), with a C-terminal amide. Its molecular formula is C149H246N44O42S, its molecular weight is about 3357.9 g/mol and its CAS number is 86168-78-7. Sermorelin Pro is supplied as a lyophilized powder in a 10 mg vial. Sold for research use only.

What has sermorelin been examined for in published research?

Published studies have used GHRH(1-29)NH2 and its analogues to map binding at GHRH receptor sites in rat anterior pituitary membranes (Gaudreau et al., 1992, PMID 1534126), and to study activation of the cloned GHRH receptor and cAMP signaling (Mayo, 1992, PMID 1333056). This work was pre-clinical. Astramide makes no claim about outcomes in humans.

What purity does the current Sermorelin Pro lot reach?

Lot PLB-SER-20260712-01 returned 99% chromatographic purity by HPLC at 274 nm, reported by pH Solutions Lab on 5 September 2026 under certificate PLB-COA-SER-20260712-01. Identity is supported by HPLC retention-time match to a certified reference standard; this certificate does not include mass spectrometry. The full certificate is published on this page.

How much sermorelin is in the vial?

The label claim is 10 mg per vial, and the certificate lists a target fill of 10.00 mg per vial. A measured net content result was not reported on this certificate for lot PLB-SER-20260712-01, and the page shows that row as not reported rather than estimating a figure.

How should sermorelin be stored for research use?

Lyophilized sermorelin is stored at -20°C and protected from light. Once reconstituted, the solution is held at 2 to 8°C and used within 14 to 30 days. Repeated temperature cycling and exposure to moisture should be avoided, because both can affect peptide stability and the comparability of experimental results.

What is the difference between sermorelin and GHRH?

Native human GHRH is a 44-amino-acid peptide. Sermorelin contains only residues 1 to 29, with a C-terminal amide, which structure-function studies identified as the region that retains receptor binding and activation (Gaudreau et al., 1992, PMID 1534126). Both act at the same receptor, GHRHR, a class B G protein-coupled receptor (Zhou et al., 2020, PMID 33060564).

How is Astramide's Sermorelin Pro tested?

Lot PLB-SER-20260712-01 was tested by pH Solutions Lab, an independent ISO/IEC 17025:2017 accredited laboratory (PJLA #84351). The certificate reports chromatographic purity by HPLC at 274 nm, a qPCR microbial panel of six organisms (all not detected) and water activity of 0.46 aw against a limit of 0.65 aw. Results apply only to this lot.

What does Pro Series mean for Sermorelin Pro?

Sermorelin Pro is part of the Astramide Pro Series. It is American-made, synthesized in the USA, and moves by domestic ground and air only, with no ocean freight. It is released under its own lot, and only when HPLC purity measures at or above 99%. The full certificate for each lot is published on this page.

Research use only

This product is intended strictly for in-vitro laboratory research conducted by qualified professionals. It is not intended for human or animal consumption, clinical use, or therapeutic application. The statements on this page have not been reviewed by the FDA. These research peptides are not intended to diagnose, treat, cure, or prevent any disease. Research Use Only.

COA library Every lot we have tested Search by batch number. Past lots stay published. How we test The analytical panel What each method measures and the criterion each lot must meet. Open Lab Send us your peptides Any vendor. Same lab. Your own Certificate of Analysis.
Ships from Austin, TexasUSPS or UPS, your choice
United States onlyFree shipping at $150 and over
Optional shipping insuranceAdded at checkout
Replacement or store creditOn approved claims. See refund policy.

Related products